PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006755-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 298aa    MW: 34143.3 Da    PI: 5.8317
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006755-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.31.3e-161562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l  +v q+G ++W+t++ + g+ R +k+c++rw +yl
    NNU_006755-RA 15 KGLWSPEEDQRLRSYVLQHGHDCWSTVPIKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding55.51.3e-1768113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +T eE+e ++ +++qlG++ W+ Ia+ ++ gRt++++k++w++yl
    NNU_006755-RA  68 RGVFTIEEEETILYLHRQLGNK-WSQIAQNLP-GRTDNEIKNHWNSYL 113
                      899*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6971062IPR017930Myb domain
SuperFamilySSF466892.53E-2813109IPR009057Homeodomain-like
SMARTSM007179.3E-111464IPR001005SANT/Myb domain
PfamPF002493.6E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-211669IPR009057Homeodomain-like
CDDcd001673.05E-91862No hitNo description
PROSITE profilePS5129426.3463117IPR017930Myb domain
SMARTSM007174.7E-1567115IPR001005SANT/Myb domain
PfamPF002493.1E-1568113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2570116IPR009057Homeodomain-like
CDDcd001673.66E-1171113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MGCKSCDKPK PKYRKGLWSP EEDQRLRSYV LQHGHDCWST VPIKAGLQRN GKSCRLRWIN  60
YLRPGLKRGV FTIEEEETIL YLHRQLGNKW SQIAQNLPGR TDNEIKNHWN SYLKKKAMKI  120
EALEAHINAQ FLNSTPKVRE SAPTLNSNIQ VSSFESLEQT GESTIDTDQS VTQIVVDNQP  180
HKATLQSSLP KLLFADWLSM DQINDQNVVS SGETMVVPSL ISDDSNVEDS LFRHNLLRDE  240
AEFASDFHNG LSNIGTTYGK FPIQIEAENN QIPENGFFDF VSMRDMYNDF DMTHDVIY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-261111723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255447.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K42e-62LAF1_ARATH; Transcription factor LAF1
TrEMBLE0CUH51e-101E0CUH5_VITVI; Putative uncharacterized protein
STRINGVIT_16s0050g00050.t011e-101(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.11e-63myb domain protein 18